PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000389.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 88aa    MW: 9470.67 Da    PI: 8.776
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000389.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.26.3e-312882358
              ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                              vrY eC++N Aa++Ggh++DGC Efmps g egt+aal+CaACgCHR+FHR+ v+
  Itr_sc000389.1_g00005.1 28 IVRYGECQRNYAATTGGHVLDGCLEFMPS-GGEGTPAALTCAACGCHRSFHRQVVV 82
                             589*************************9.8899******************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-162981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.8E-292980IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-253079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.1673180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MKRSIRVDDR LDSTRRYTAG TTSRVTTIVR YGECQRNYAA TTGGHVLDGC LEFMPSGGEG  60
TPAALTCAAC GCHRSFHRQV VVSVATST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483621.17e-25PREDICTED: mini zinc finger protein 2-like
SwissprotQ0J5F86e-23MIF4_ORYSJ; Mini zinc finger protein 4
SwissprotQ9SVL09e-23ZHD7_ARATH; Zinc-finger homeodomain protein 7
TrEMBLA0A0D2RP221e-24A0A0D2RP22_G
TrEMBLA0A151SL864e-25A0A151SL86_CAJCA; ZF-HD homeobox protein At4g24660 family
STRINGSb08g001830.12e-23(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50890.16e-24homeobox protein 28